
Selasa, 08 November 2011

makalah normativitas dan historisitas studi islam

Fenomena keberagaman manusia dapat dilihat dari berbagai sudut pendekatan. Tidak lagi hanya dapat dilihat dari sudut dan semata-mata terkait dengan normativitas ajaran wahyu, meskipun fenomena ini sampai kapan pun adalah ciri   daripada agama-agama yang ada. Tetapi juga dapat dilihat dari sudut dan terikat erat dengan historisitas pemahaman dan interpretasi orang-perorang atau kelompok-perkelompok terhadap norma-norma ajaran agama yang dipeluknya, serta model-model amalan dan praktek-praktek ajaran agama yang dilakukanya dalam kehidupan sehari-hari. Pada umumnya, normativitas ajaran wahyu dibangun, diramu, dibakukan dan ditelaah lewat pendekatan doktrinal-teologis, sedang historisitas keberagaman manusia ditelaah lewat berbagai sudut pendekatan keilmuwan sosial-keagamaan yang bersifat multi dan inter disipliner, baik lewat pendekatan historis, filosofis, psikologis, sosiologis, kultural maupun antropologis.
Pendekatan dan pemahaman terhadap fenomena keberagaman yang bercorak normatif dan historis tidak  selamanya akur dan seirama. Hubungan antara keduanya seringkali diwarnai dengan tension atau ketegangan, baik yang bersifat kreatif maupun destruktif. Pendapatan yang pertama, lantaran ia berangkat dari  teks  sudah tertulis dalam kitab suci masing-masing agama, sampai batas-batas tertentu adalah bercorak literalis, tekstualis, atau skriptualis. Pendekatan terhadap fenomena keberagaman yang kedua dituduh oleh yang pertama sebagai pendekatan dan pemahaman keagamaan yang bersifat “reduksionis”, yakni pemahaman keagamaan yang hanya terbatas pada aspek eksternal-lahiriah dari keberagaman manusia dan kurang begitu memahami, menyelami dan menyentuh aspek batiniah-eksoteris serta makna terdalam dan moralitas yang terkandung oleh ajaran agama-agama itu sendiri. Sedang pendekatan studi agama yang kedua, yang lebih bersifat historis balik menuduh corak pendekatan yang pertama sebagai jenis pendekatan dan pemahaman keagamaan yang cenderung bersifat “absolutis”, lantaran pendekatan pertama ini cenderung mengabsolutkan teks yang sudah tertulis, tanpa berusaha memehami lebih dahulu apa  sesungguhnya yang melatarbelakangi berbagai teks keagamaan yang ada.
Hubungan antara keduanya tidaklah harus dibuat tegang dan kaku seperti itu. Kontroversi antara absolutis dan relativis dalam arti reduksionis kurang begitu relevan untuk melihat realitas konkret fenomena keberagaman manusia secara utuh. Menentukan bentuk hubungan yang pas antara keduanya adalah merupakan separoh jalan untuk mengurangi ketegangan hubungan antara kedua corak pendekatan tersebut.
Menurut ijtihad penulis, hubungan antara keduanya adalah ibarat sebuah koin (mata uang) dengan dua permukaan. Hubungan antara kedua permukaan koin tidak dapat dipisahkan, tetapi secara tegas dan jelas dapat dibedakan.[1]
Pemahaman terhadap keIslaman selama ini dipahami sebagai dogma yang baku dan menjadi suatu norma yang tidak dapat dikritik, dan dijadikan sebagai pedoman mutlak yang tidak saja mengatur tingkah laku manusia, melainkan sebagai pedoman untuk menilai dogmatika yang dimiliki orang lain, meskipun demikian dogmatika tersebut tidak dapat dilepaskan dari segi sejarah pembentukan dogma itu sendiri.
Dalam suatu penelitian, peneliti menemukan bentuk pemikiran Amin Abdullah tentang pendekatan historisitas dan normativitas. Sisi historisitas merupakan bentuk sejarah bagaimana dogmatika itu muncul, sedangkan normativitas adalah aturan baku itu sendiri, yang mana tidak dapat dilepaskan dari pemikiran tentangnya. Dimana penafsiran tentang dogmatika tersebut, tidak hanya ditentukan oleh teks tunggal, melainkan juga kepentingan, kondisi, maupun prejudice yang mendasari penafsiran juga muncul dalam pemikiran keIslaman, yang kini telah dibakukan dan dijadikan pedoman mutlak.[2]
1.       Pengertian Normativitas dan Historisitas
A. Pengartian Normativitas
Kata normatif berasal dari bahasa Inggris norm yang berarti norma ajaran, acuan, ketentuan tentang masalah yang baik dan buruk yang boleh dilakukan dan yang tidak boleh dilakukan. Pada aspek normativitas, studi Islam agaknya masih banyak terbebeni oleh misi keagamaan yang bersifat memihak sehingga kadar muatan analisis, kritis, metodologis, historis, empiris terutama dalam menelaah teks-teks atau naskah keagamaan produk sejarah terdahulu kurang begitu ditonjolkan, kecuali dalam lingkungan peneliti tertentu yang masih sangat terbatas.[3]
B.Pengartian Historisitas
  Menurut Kamus Besar Bahasa Indonesia, historis yaitu berkenaan dengan sejarah, bertalian atau ada hubunganya dengan masa lampau. Sedangkan historisitas yaitu segala sesuatu yang berhubungan dengan sejarah, kesejarahan.[4]
Dalam kamus umum bahasa Indonesia, W.J.S. Poerwadaminta mengatakan sejarah adalah kejadian dan peristiwa yang benar-benar terjadi pada masa lampau atau peristiwa penting yang benar-benar terjadi. Definisi tersebut terlihat menekankan kepada materi peristiwanya tanpa mengaitka dengan aspek lainnya. Sedangkan dalam pengartian yang lebih komprehensif suatu peristiwa sejarah perlu juga di lihat siapa yang melakukan peristiwa tersebut, dimana, kapan, dan mengapa peristiwa tersebut terjadi.
Dari pengertian demikian kita dapat mengatakan bahwa yang dimaksud dengan sejarah Islam adalah peristiwa atau kejadian yang sungguh-sungguh terjadi yang sluruhnya berkaitan dengan ajaran Islam diantara cakupannya itu ada yang berkaitan dengan sejarah proses pertumbuhan, perkembangan dan penyebarannya, tokoh-tokoh yang melakukan pengembangan dan penyebaran agama Islam tersebut,  sejarah kemajuan dan kemunduran yang di capai umat Islam dalam berbagai bidang,seperti dalam bidang pengetauan agama dan umum, kebudayaan, arsitektur, politik, pemerintahan, peperangan, pendidikan, ekonomi dan lain sebagainya.[5]
2.Pengelompokkan Islam Normatif dan Islam Historis
Ketika melakukan studi atau penelitian Islam, perlu lebih dahulu ada kejelasan islam mana yang diteliti; Islam pada level mana. Maka penyebutan Islam normatif dan islam Historis adalah salahsatu dari penyebutan level tersebut. Istilah yang hampir sama dengan islam Normatif dan Islam Historis adalah Islam sebagai wahyu dan Islam sebagai produk sejarah. Sebagai wahyu, Islam didefinisikan sebagaimana ditulis sebelumnya di atas, yakni:
Wahyu ilahi yang diwahyukan kepada nabi Muhammad SAW. Untuk kebahagiaan kehidupan dunia dan akhirat.
Sedangkan Islam Historis atau Islam sebagai produk sejarah adalah Islam yang dipahami dan islam yang dipraktekkan kaum muslim di seluruh penjuru dunia, mulai dari masa nabi Muhammad SAW sampai sekarang.
Pengelompokkan Islam normatif dan Islam historis menurut Nasr Hamid Abu Zaid mengelompokkan menjadi tiga wilayah (domain).
Pertama, wilayah teks asli Islam (the original text of Islam), yaitu Al-qur’an dan sunnah nabi Muhammad yang otentik.
Kedua, pemikiran Islam merupakan ragam menafsirkan terhadap teks asli Islam (Al-qur’an dan sunnah nabi Muhammad SAW). Dapat pula disebut hasil ijtihad terhadap teks asli Islam,seperti tafsir dan fikih. Secara rasional ijtihad dibenarkan, sebab ketentuan yang terdapat di dalam al-Qur’an dan al-Sunnah itu tidak semua terinci, bahkan sebagian masih bersifat global yang membutuhkan penjabaran lebih lanjut. Di samping permasalahan kehidupan selalu berkembang terus, sedangkan secara tegas permasalahan yang timbul itu belum/tidak disinggung. Karena itulah diperbolehkan berijtihad, meski masih harus tetap bersandar kepada kedua sumber utamanya dan sejauh dapat memenuhi persyaratan. Dalam kelompok ini dapat di temukan empat pokok cabang : (1) hukum/fikih,(2) teologi,(3) filsafat, (4) tasawuf. Hasil ijtihad dalam bidang hukum muncul dalam bentuk : (1) fikih, (2) fatwa, (3) yurisprudensi (kumpulan putusan hakim), (4) kodikfikkasi/unifikasi, yang muncul dalam bentuk Undang-Undang dan komplikasi.
Ketiga, praktek yang dilakukan kaum muslim. Praktek ini muncul dalam berbagai macam dan bentuk sesuai dengan latar belakang sosial (konteks). Contohnya : praktek sholat muslim di Pakistan yang tidak meletakkan tangan di dada. Contohnya lainnya praktek duduk miring ketika tahiyat akhir bagi muslim Indonesia, sementara muslim di tempat/ negara lain tidak melakukannya.
Sementara Abdullah Saeed menyebut tiga tingkatan pula, tetapi dengan formulasi yang berbeda sebagai berikut :
Tingkatan pertama, adalah nilai pokok/dasar/asas, kepercayaan, ideal dan institusi-institusi.
Tingkatan kedua adalah penafsiran terhadap nilai dasar tersebut, agar nilai-nilai dasar tersebut dapat dilaksanakan/dipraktekkan.
Tingkatan ketiga manifestasi atau pratek berdasarkan pada nilai-nilai dasar tersebut yang berbeda antara satu negara dengan negara lain, bahkan antara satu wilayah dengan wilayah lain. Perbedaan tejadi karena perbedaan penafsiran dan perbedaan konteks dan budaya.
Pada level teks, sebagaimana telah ditulis sebelumnya, Islam didefinisikan sebagai wahyu. Pada dataran ini, Islam identik dengan nash wahyu atau teks yang ada dalam al-Qur’an dan sunnah nabi Muhammad. Pada masa pewahyuannya memakan waktu kurang lebih 23 tahun.
Pada teks ini Islam adalah nash yang menurut hemat penulis, sesuai dengan pendapat sejumlah ilmuwan(ulama) dapat dikelompokkan menjadi dua, yakni :
1. Nash prinsip atau normatif-universal, dan
2. Nash praktis-temporal
Nash kelompok pertama, nash prinsip atau normatif-universal, merupakan prinsip-prinsip yang dalam aplikasinya sebagian telah diformatkan dalam bentuk nash praktis di masa pewahyuan ketika nabi masih hidup.
Adapun nash praktis-temporal, sebagian ilmuwan menyebutnya nash konstektual, adalah nash yang turun (diwahyukan) untuk menjawab secara langsung (respon) terhadap persoalan-persoalan yang dihadapi masyarakat muslim Arab ketika pewahyuan. Pada kelompok ini pula Islam dapat menjadi fenomena sosial atau Islam aplikatif atau Islam praktis.
Dengan penjelasan di atas tadi dapat ditegaskan, syari’ah sebagai the original text mempunyai karakter mutlak dan absolut, tidak berubah-ubah. Sementara fiqh sebagai hasil pemahaman terhadap the original text mempunyai sifat nisbi/relatif/zanni, dapat berubah sesuai dengan perubahan konteks; konteks zaman; konteks sosial; konteks tempat dan konteks lain-lain.
Sementara dengan menggunakan teori Islam pada level teori dan Islam pada level praktek dapat dijelaskan demikian. Untuk menjelaskan posisi syari’at pada level praktek perlu dianalogkan dengan posisi nash, baik al-Qur’an maupun sunnah nabi Muhammad SAW. Dapat disebutkan bahwa pada prinsipnya nash tersebut merupakan respon terhadap masalah yang dihadapi masyarakat arab di masa pewahyuan. Kira-kira demikianlah posisi Islam yang kita formatkan sekarang untuk merespon persoalan yang kita hadapi kini dan di sini. Perbedaan antara nash dan format yang kita rumuskan adalah, bahwa nash diwahyukan pada nabi Muhammad, sementara format yang kita rumuskan sekarang adalah format yang dilandaskan pada nash tersebut. Hal ini harus kita lakukan, sebab persoalan selalu berkembang dan berjalan maju, sementara wahyu sudah berhenti dengan meninggalnya nabi Muhammad SAW.[6]
Duahaltersebutmengundangpermasalahan, bagaimanahubungansifatkeilmiahan di satupihak, dan di lain pihak Islam sebagaipandanganhidupdiangkatsebagaiobyekstudi. Apakah Islam perludikajisecarailmiah, ataukahcukuphanyadiamalkansaja.Permasalahan yang lebihekstrimlagi, mana yang lebihtepatmenjadikan Islam sebagaiobyekkajianilmiahataucukupdijadikanpedomanhidup yang tanpaperubahandankekurangan.Permasalahansemacamitusebenarnyamerupakanpermasalahanklasik yang menjadiperdebatanpadaabadtengahantara al-GhazalidanIbnRusyd, yang mempertanyakanbagaimanahukumnyamempelajarifilsafat.Dan IbnRusydtelahmenjelaskanpermasalahannyalewatbukunyaFasl al-Maqal,tetapitampaknyatidakcukupmencerahkanbagipemikiranortodoksikeagamaan yang mulaimengkristal.
Permasalahantersebutmenjadisulit, karenasikapkeagamaan yang baikuntukdapatmembedakanantaraaspeknormatifdenganaspekhistoriskeagamaan, terutamakeagamaan Islam.Menurut Muhammad Arkoun, sejakabad 12 hinggaabad 19, bahkansampaisekarangterjadi proses sakralisasipemikirankeagamaan, sehinggatidakadakekurangan, yang olehFazlurRahmandisebut proses “ortodoksi” baikbagi Sunni maupunSyi’i. Makaterjadi proses pencampuran yang lekatantaraaspekhistoriskekhalifahan yang normanyaselaluberubah, karenaprodukzamandannormativitas al-Qur’an dankeagamaan Islam yang universal. Sebenarnyakeduanyadapatdibedakan, meskipuntidakdapatdipisahkan, karenamemilikihubungan yang dialektis, menyatudalamsatukesatuan, tanpaberhentipadasuatusisi, meninggalkanaspekhistoriskemanusiaanataumeninggalkanaspeknormatif yang dihayatiparapemeluk agama.Arkounmenjelaskan, sejakabadke 12 hinggasekarangterjadipenepianaspekhistoriskemanusiaan yang selaludalam proses danpembentukan. Secaraontologis, dalamkeagamaan Islam dapatdigambarkansebuahmatauanglogam yang mempunyaiduapermukaan, yaitudalamkeberagamaan Islam terdapatduapermukaan yang menyatupadasuatukesatuan yang utuh, yakniaspeknormatifdanhistoris.Keduanyamenyatu, tidakdapatdisahkan, tetapidapatdibedakan.[7]
Hubungan antara kedua jenis pendekatan agama tersebut (normatif dan historis) memang tidak dapat mengendalikan hubungan yang bersifat antagonistik. Hubungan antar keduanya perlu bersifat “dialektis”, sehingga saling mempengaruhi hubungan dialektis tersebut, dan dari keduanya dapat ditumbuhkan potensi untuk saling mengoreksi, menegur, dan memperbaiki kekurangan yang melekat pada dideteksi dan dipilah-pilah sejauh mana aspek-aspek eksternal seperti interes politik, ekonomis hegemoni kultural, yang ikut campur aduk dalam praktek-praktek ajaran teologis tertentu. [8]
Satucontoh, peristiwa yang disebutkanpadasurat ‘Abasaayat 1-11, tampakaspekhistoriskenabian Muhammad saw ketikaberhadapandengan ‘Abdullah ibnUmmiMaktum yang buta. Peristiwahistorisitutidakada yang sakral, sebabhanyalahhubunganantarmanusiasaja.Kekuatanrasiomanusialah yang mampumenembusaspeknormatif al-Qur’an yang bersifatkepastian (fard al-‘ain) yang universal.Peristiwahistorisitubentuknyadapatbergantiseribumacam, sehinggapersoalankhususNabi Muhammad saw dengan Abdullah ibnUmmiMaktumdapat pula bergantibentuksesuaidengansituasihistorisdanperkembanganilmupengetahuan. Tetapi, aspeknormatifdanetika al-Qur’an yang bersifatkepastian, fard al-‘ain,tetapsamadaridulusampaikapanpun, yaknikewajibanmemperlakukan orang lain dalamberbagaistratifikasisosial yang adasecarasantun, demokratis, egaliterdanadil. Aspekuniversalitas-intelektualitasdariajaran Islam terletakpadanormativitas-etika yang mengikatsemuapihak, sedangaspekpartikularitas-kulturalnyaterletakpadaperistiwaperilakuNabi Muhammad saw dannabi-nabilainnya.
Dalamkeragaman Islam, terdapatduaaspekbersama-sama, yakniaspeknormatif, wahyu, danaspekhistoriskekhalifahan.Menurutparafuqaha’ aspeknormatifadalahaspekibadahmahdah yang ditekankanpadaaspek-aspeklegalitasformalitas-eksternal, sehinggakurangapresiatifterhadapdimensiesoteris, yang jugamelekatpadareligiusimperatif yang bersifatmahdhahtersebut.Sedangaspekhistorisbaik yang berkaitandenganpersoalansosial, politik, budayaekonomi, pendidikan, lingkunganhidup, kemiskinandansebagainyadianggaptermasukghairumahdhah, sehinggadikategorikanfardkifayah.Pengkategoriansemacaminiberdampakdalampemikirandemikianbesardalamtatananpemikiranumat Islam, yaknipermasalahan yang masukdalamkategorifardkifayahkurangdiminati, lantaransudahterselesaikanlewatperwakilanbeberapakalangansaja.Sedangkanperwakilanitusendiritidakjelas.Jadi, jikadalamkelompokibadahmahdhahcampurtanganakalpikirantidakdiperbolehkan, makakelompokfardkifayahinilah yang sebenarnyamenumbuhkanwacanaintelektual yang kritisdanobyektif.Sebab, dalamwilayahfardkifayahiniterdapatpergumulandanwacanaepistemologikeislaman yang berat, dan di sini pula membutuhkanpendekatanempiris yang obyektifdanrasional. Hal inibisadimengertilantaranterikatdalamkontekswaktu, ruang, historis, kultur, danpsikologi[tertentu, sehinggatetapmemberikanpeluanguntuksenantiasadidiskusikan.[9]
4.Keterkaitan normativitas dan historisitas dalam studi keIslaman.
Dari perspektif filsafat ilmu, setiap ilmu, baik itu ilmu alam, humaniora, social, agama atau ilmu-ilmu keIslaman, harus diformulasikan dan dibangun di atas teori-teori yang berdasarkan pada kerangka metodologi yang jelas. Teori-teori yang sudah ada terlebih dahulu tidak dapat dijadikan garansi kebenaran. Anomali-anomali dan pemikiran-pemikiran yang tidak, kenyataannya ilmu pengetahuan tidak tumbuh dalam kevakuman, akan tetapi selalu dipengaruhi dan tidak dapat terlepas dari pengaruh cita rasa sejarah sosial dan politik. Pemikiran ini muncul dari adanya kesadaran bahwa teori-teori ilmu pengetahuan hanyalah merupakan produk, hasil karya manusia.
Dalam pengertian ini, penerapan filsafat ilmu pada diskusi akademik ilmu-ilmu keIslaman harus dilakukan, karna filsafat ilmu saling berkaitan dengan sosiologi ilmu pengetahuan. Dua cabang ilmu pengetahuan ini jarang didiskusikan dan tidak pernah dimasukan dalam tradisi ilmu keIslaman yang ada. Padahal keduanya merupakan prasyarat dan wacana awal yang harus dimengerti bagi para ilmuan muslim yang ingin terhindar dari tuduhan pembela tipe studi Islam yang hanya bersifat pengulang-ngulangan, statis, disakralkan dan dogmatik.
Ketika pada akhirnya menghadapi masalah-masalah historisitas pengetahuan, patut disayangkan bila sarjana-sarjana muslim dan non muslim yang hendak mengembangkan wacana mereka dalam ilmu-ilmu keIslaman secara psikologi merasa terintimidasi dengan problem reduksionisme dan non reduksionisme. Dalam hal-hal tertentu, ada beban psikologis dan institusional yang terlibat dalam memperbesar dan memperluas domain, scope dan metodologi ilmu-ilmu keIslaman karena persoalan itu. Sejak awal mula Fazlur Rahman sendiri telah menempatkan Islam normative dalam kerangka kerjanya atau sebagai hard core dalam kerangka kerja Lakatos, yang harus dilindungi dengan sifat-sifatnya yang mendorong pada penemuan-penemuan dan penyelidikan-penyelidikan baru (positive heuristic). Hard core atau Islam normative sama dengan apa yang telah ditetapkan sebagai objek studi agama yang tepat dengan menggunakan pendekatan fenomenologis.
Bangunan baru ilmu-ilmu keIslaman, setelah diperkenalkan dan dihubungkan dengan wacana filsafat ilmu dan sosiologi ilmu pengetahuan, lebih lanjut harus mempertimbangkan penggunaan sebuah pendekatan dengan tiga dimensi untuk melihat fenomena agama Islam, yakni pendekatan yang berunsur linguistic- historis, teologis-filosofis, dan sosiologis-antropologis pada saat yang sama. Tentang apa dan bagaimana pendekatan tersebut sudah banyak ditulis oleh para ahlinya.
Dengan demikian, ilmu-ilmu keIslaman yang kritis, sebagaimana yang dinyatakan oleh Fazlur Rahman dan Mohammed Arkoun beserta kolega-kolega mereka yang memiliki keprihatinan yang sama, hanya dapat dibangun secara sistematik dengan menggunakan model gerakan tiga pendekatan secara sirkuler, dimana masing-masing dimensi dapat berinteraksi, berinterkomunikasi satu dengan lainnya. Masing-masing pendekatan berinteraksi dan dihubungkan dengan yang lainnya. Tidak ada satu pendekatan maupun disiplin yang dapat berdiri sendiri. Gerakan dinamis ini pada esensinya adalah hermeneutic. [10]
Kata normatif berasal dari bahasa Inggris norm yang berarti norma ajaran, acuan, ketentuan tentang masalah yang baik dan buruk yang boleh dilakukan dan yang tidak boleh dilakukan.
Menurut Kamus Besar Bahasa Indonesia, historis yaitu berkenaan dengan sejarah, bertalian atau ada hubunganya dengan masa lampau. Sedangkan historisitas yaitu segala sesuatu yang berhubungan dengan sejarah, kesejarahan.
Pengelompokkan Islam normatif dan Islam historis menurut Nasr Hamid Abu Zaid mengelompokkan menjadi tiga wilayah yaitu:Pertama, wilayah teks asli Islam (the original text of Islam), yaitu Al-qur’an dan sunnah nabi Muhammad yang otentik. Kedua, pemikiran Islam merupakan ragam menafsirkan terhadap teks asli Islam (Al-qur’an dan sunnah nabi Muhammad SAW), Ketiga, praktek yang dilakukan kaum muslim.
Dalamkehidupankeagamaan, khususnyadalampemikirankeagamaan Islam terdapataspeknormatifdanhistoris.Keduaaspekituterdapathubungan yang menyatu, tidakdapatdipisahkan, tetapidapatdibedakan.
Aspeknormatif, wahyu, harusditerimasebagaimanaadanya, mengikatsemuapihak, danberlaku universal.Sedangaspekhistoriskekhalifahan, senantiasadapatberubah, menerimadiskusi, karenaprodukzamantertentu, danbukanhal yang sakral.
Keterkaitan normativitas dan historisitas dalam studi keIslaman. hanya dapat dibangun secara sistematik dengan menggunakan model gerakan tiga pendekatan secara sirkuler, dimana masing-masing dimensi dapat berinteraksi, berinterkomunikasi satu dengan lainnya.


Amin Abdullah, Islamic Studies di Perguruan Tinggi Pendekatan Integratif-Interkonektif, Pustaka Pelajar: Yogyakarta, 2006,
Amin Abdullah, Studi Agama Normativitas atau historisitas?, Pustaka Pelajar: Yogyakarta,1996,
Departemen Pendidikan dan Kebudayaan RI, Kamus Besar Bahasa Indonesia edisi kedua, Balai Pustaka: Jakarta,

[1]Amin Abdullah, Studi Agama Normativitas atau historisitas?, Pustaka Pelajar: Yogyakarta,1996,
[4]Departemen Pendidikan dan Kebudayaan RI, Kamus Besar Bahasa Indonesia edisi kedua, Balai Pustaka: Jakarta,

[8]Amin Abdullah, Studi Agama Normativitas atau historisitas?, Pustaka Pelajar: Yogyakarta,1996, hal.16-17

[10]Amin Abdullah, Islamic Studies di Perguruan Tinggi Pendekatan Integratif-Interkonektif, Pustaka Pelajar: Yogyakarta, 2006, hal. 60-65

Tidak ada komentar:

Poskan Komentar

Poskan Komentar